PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_37527_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 142aa    MW: 15982.7 Da    PI: 5.8055
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_37527_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1980132254
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     rk+ +++keq + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+
  Neem_37527_f_1  80 RKKLRLSKEQSRLLEESFRQNHTLNPKQKEALATQLKLRPRQVEVWFQNRRAR 132
                     788899**********************************************9 PP

2HD-ZIP_I/II80.33e-2680133154
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARt 54 
                     +kk+rlskeq++lLEesF+++++L+p++K++la++L+l+prqv+vWFqnrRAR 
  Neem_37527_f_1  80 RKKLRLSKEQSRLLEESFRQNHTLNPKQKEALATQLKLRPRQVEVWFQNRRARS 133
                     69***************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1864132IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1965132IPR009057Homeodomain-like
PROSITE profilePS5007116.37476136IPR001356Homeobox domain
SMARTSM003894.9E-1478140IPR001356Homeobox domain
CDDcd000866.27E-1679133No hitNo description
PfamPF000461.9E-1680132IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MAVLPRSSSS LELTISVPGF SSSPSLPASS GDQQNQLAAF TMKDLDINQI PTGEGGEEEY  60
WNATGSMEDE EESSNGGPPR KKLRLSKEQS RLLEESFRQN HTLNPKQKEA LATQLKLRPR  120
QVEVWFQNRR ARSFHYFVGG WD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657445.13e-62PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ8S9N64e-46ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLD7T8T64e-62D7T8T6_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g04870.t011e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-43homeobox-leucine zipper protein 17